BPC-157 vs TB-500: side-by-side on chemistry, mechanism, and stack rationale
The two most-requested repair peptides compared on sequence, mechanism, analytics, and why the Wolverine Blend combines them rather than dosing them sequentially.
Published May 15, 2026 · 9 min read · By PeptideXpo Regulatory Team
BPC-157 and TB-500 are the two most-requested repair peptides at PeptideXpo's quote desk, and they are also the two most commonly confused. Both are studied for tissue-repair applications, both are under FDA PCAC review for the July 2026 503A bulks list, and both are routinely combined in compounding and research workflows. But the molecules are chemically distinct, mechanistically distinct, and operationally distinct, buyers should choose between them based on what their downstream application actually needs.
At a glance
| Property | BPC-157 | TB-500 |
|---|---|---|
| Sequence length | 15 amino acids | 43 amino acids |
| Sequence | GEPPPGKPADDAGLV | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| CAS | 137525-51-0 | 885340-08-9 |
| MW | 1419.55 g/mol | ≈4963 g/mol |
| Native parent | Body Protection Compound (gastric juice) | Thymosin β4 fragment |
| Mechanism | NO pathway + growth-factor cross-talk | Actin-binding, cellular migration |
| Oral bioavailability | Some, proline-rich, protease-resistant | Negligible, injection-only |
| Synthesis | Reliable | More demanding |
| Sequence-verification urgency | Moderate | High |
| 503A bulks-list status | Under PCAC review (July 2026) | Under PCAC review (July 2026) |
Mechanism, complementary, not redundant
This is the key concept and the reason the two peptides are combined rather than alternated.
BPC-157 signals through nitric-oxide-pathway modulation and growth-factor-receptor cross-talk. Published mechanistic studies show effects on VEGF, FGF-2, and EGFR-pathway signaling, with downstream consequences for angiogenesis, gastric-mucosa healing, and tendon-fibroblast activation.
TB-500 binds actin monomers and prevents their incorporation into actin filaments, the central LKKTETQ motif is the actin-binding region. The downstream consequence is enhanced cellular migration (because actin-monomer pool availability affects motility), angiogenesis through endothelial-cell migration, and tissue-remodeling through fibroblast migration.
These are entirely different molecular mechanisms. The "repair-stack" rationale isn't "one of them works, dose both for redundancy", it's "they act on parallel pathways, dose both for additive effects across pathways." Published research on the BPC + TB combination supports the additivity hypothesis.
Analytical considerations
For a 15-residue BPC-157, mass-spec identity confirmation is often used alongside chromatography. LC-MS/MS is not automatically required because a supplier is new; include it only when the buyer's written procedure calls for sequence-level evidence and agree the method, timing, and cost before quotation.
For a 43-residue TB-500, mass alone leaves more identity ambiguity because single-residue deletion products elute close to the target peak on RP-HPLC and pass the mass check within tolerance. LC-MS/MS sequence verification is available when required by a written analytical scope and is the analytical practice that meaningfully distinguishes one TB-500 supplier from another.
Operational guidance
For research and compounding workflows using either peptide alone:
- BPC-157 alone: standard 2-10 mg lyophilized vials. Reconstitute in BWFI for multi-use, SWFI for single-use. Aliquot into single-use volumes; freeze-thaw discipline matters.
- TB-500 alone: standard 2-10 mg lyophilized vials. Same reconstitution guidance. TB-500 is somewhat more adsorptive than BPC-157, consider low-bind plasticware for working dilutions below 100 µg/mL.
For workflows using both peptides (the canonical case):
- Use the Wolverine Blend SKU rather than self-mixing from separate vials. The co-lyophilized blend certifies the actual ratio in the released vial and simplifies the analytical chain. Standard ratio is 1:1 by mass (5+5 mg or 10+10 mg), with custom ratios available via OEM service.
Regulatory trajectory
Both peptides are on the July 2026 PCAC agenda for 503A bulks-list consideration. BPC-157 is proposed for ulcerative colitis indication; TB-500 is proposed for wound healing. The PCAC recommendations are advisory; FDA's decision typically follows several months later. For procurement teams: regardless of how PCAC votes, the documentation-depth expectations buyers will hold suppliers to are already structurally raised compared with the pre-PCAC-review era.
Frequently asked questions
- What is the difference between BPC-157 and TB-500?
- They are chemically and mechanistically distinct repair peptides. BPC-157 is a 15-amino-acid peptide (GEPPPGKPADDAGLV, CAS 137525-51-0, ~1419.55 g/mol) derived from Body Protection Compound in gastric juice, acting through the nitric-oxide pathway and growth-factor cross-talk. TB-500 is a 43-amino-acid Thymosin β4 fragment (CAS 885340-08-9, ≈4963 g/mol) acting through actin-binding and cellular migration. BPC-157 is proline-rich and partly protease-resistant; TB-500 is injection-only.
- Why are BPC-157 and TB-500 combined in the Wolverine Blend?
- They are combined for mechanistic complementarity: BPC-157 works through the nitric-oxide and growth-factor pathway while TB-500 works through actin-binding and cellular migration, so one co-formulated vial covers two distinct repair mechanisms. Co-lyophilization in a single vial preserves the ratio better than a buyer mixing two separately-sourced vials in solution.
- Which needs LC-MS/MS sequence verification more, BPC-157 or TB-500?
- TB-500 is longer and may justify sequence-level evidence in some protocols. Ask sales for the applicable batch COA first. If LC-MS/MS is required by the buyer's written procedure, agree the method, reporting scope, timing, and cost before quotation.