Ask sales for the lot-numbered COA matched to the offered or supplied batch; it records the tests actually completed, their specifications, and the reported results.

Matching batch COA available.

PCAC will review 7 peptides for the 503A bulks list, BPC-157, KPV, TB-500, MOTS-c, Emideltide, Semax, Epitalon. Read our briefing →

FDA PCAC reviews 7 peptides in July. Read →

PNC-27

Name: PNC-27
Brand: PeptideXpo
SKU: pnc-27

p53-HDM2-binding · penetratin-fused research peptide

≥ 99.0%CAS Not consistently registered; see batch COALongevity Peptides

PeptideXpo buyer fit

PNC-27 for distributor assortment and OEM sourcing comparison

This PeptideXpo page is intentionally positioned for distributors, OEM buyers, and procurement teams comparing PNC-27 inside a wider peptide catalog. It is not trying to be the deepest single-molecule monograph; the differentiated intent is assortment planning, export-ready documentation, fill-size comparison, and whether this SKU belongs in a broader buyer program.

Use this page when the buyer is comparing multiple SKUs, fill ladders, repeat-order economics, or distributor/OEM sourcing routes.
For regulated compounding-pharmacy qualification, a dedicated regulated-pharmacy channel should own the pharmacy-specific head keyword.
For research-lab method development, copper-chemistry, or cosmetic-formulation depth, the matching specialist channel (research standards, copper peptides, or cosmetic actives) should own the narrower specialist intent.

Overview

PNC-27 is a 32-amino-acid fusion research peptide combining the HDM-2-binding domain of p53 (residues 12-26) at the N-terminus with the penetratin cell-penetrating peptide (residues 43-58 of the Antennapedia homeodomain) at the C-terminus. The fusion produces a molecule that can cross plasma membranes via the penetratin moiety and then engage HDM-2 (the human homolog of MDM2) intracellularly. The most studied property of PNC-27 is selective induction of membrane pore formation in cells expressing high levels of HDM-2 on the cell surface, a property associated with malignant transformation in several tumor types but absent from most healthy cells. This selectivity is the basis for PNC-27's broad use in tumor-selective membrane-disruption research. PeptideXpo supplies PNC-27 as a lyophilized powder at ≥99.0% HPLC purity. The 32-residue sequence with mixed hydrophobic and cationic regions is at the more demanding end of routine SPPS, and the analytical packet covers peak-integration HPLC, mass spec, water content, and on-request sequence verification by LC-MS/MS. The penetratin moiety makes PNC-27 prone to surface adsorption like LL-37, so working dilutions should be prepared in low-bind plasticware with BSA or Tween-20 carrier to suppress concentration loss at sub-μg/mL working concentrations.

Who buys this, and why

Buyers for longevity-class peptides span research labs working on telomere, collagen, and circadian-rhythm models, plus cosmetic-formulation OEMs incorporating peptides like GHK-Cu into anti-aging finished products. Copper peptides in particular require attention to chelator-free water and EDTA-free buffers in downstream formulation work, incompatibility there is the most common cause of "the peptide didn't work" support tickets in this class.

Primary buyer fit: academic and contract research laboratories.

Specifications

CAS: Not consistently registered; see batch COA
Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Appearance: White to off-white lyophilized powder
Purity (HPLC): ≥ 99.0%
Strength: 5 mg
Packaging: 10 vials/box · base pack (multiples of 10)
Half-life: ≈ 90 minutes
MOQ: On request
Lead time: 14–21 days
Storage: -20°C, protect from light

Documentation available on request

Certificate of Analysis (COA)
HPLC Chromatogram
Mass-spec identity (ESI-MS)
Copper-content verification (Cu-peptides only)
Stability in finished-formulation matrix
INCI naming for cosmetic use
SDS / MSDS
Sequence verification on request

Regulatory note

Research peptide; CAS is not consistently registered across suppliers. Sold for research use only.

Selected literature

Sarafraz-Yazdi E, Bowne WB, Adler V, Sookraj KA, Wu V, Shteyler V, Patel H, Oxbury W, Brandt-Rauf P, Zenilman ME, Michl J, Pincus MR. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010;107(5):1918-1923.
Sookraj KA, Bowne WB, Adler V, Sarafraz-Yazdi E, Michl J, Pincus MR. The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol. 2010;66(2):325-331.
Sarafraz-Yazdi E, Mumin S, Cheung D, Fridman D, Lin B, Wong L, Rosal R, Rudolph R, Frenkel M, Thadi A, Morano WF, Bowne WB, Pincus MR, Michl J. PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis. Biomedicines. 2022;10(5):945.
Krzesaj P, Adler V, Feinman RD, Miller A, Silberstein M, Yazdi E, Pincus MR. Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption. Ann Clin Lab Sci. 2024;54(2):137-148.
Miller AI, Miller L, Seydafkan S, Mc Glinchey S, Jafari G, Silberstein M, Krzesaj P, Feinman RD, Pincus MR. PNC-27 Kills Cervical Cancer Cells but Not Untransformed Cervical Cells, an Effect that is Enhanced by Ketone Bodies. Med Res Arch. 2025;13(5):e6471.
Sarafraz-Yazdi E, Gorelick C, Wagreich AR, Salame G, Angert M, Gartman CH, Gupta V, Bowne WB, Lee YC, Abulafia O, Pincus MR, Michl J. Ex vivo Efficacy of Anti-Cancer Drug PNC-27 in the Treatment of Patient-Derived Epithelial Ovarian Cancer. Ann Clin Lab Sci. 2015;45(6):650-658.

Frequently asked questions

What's the design rationale for PNC-27's two-domain structure?▾

PNC-27's N-terminal HDM-2-binding domain (derived from p53 residues 12-26) is the bioactive moiety, it engages HDM-2 protein and disrupts the HDM-2/membrane interaction in cells displaying surface HDM-2. The C-terminal penetratin domain (derived from the Antennapedia homeodomain) is the delivery vehicle, it confers cell-penetration capability that the bioactive moiety alone would not have. The fusion is the classic two-domain cell-penetrating-peptide design: a recognition or binding domain attached to a transduction domain, allowing intracellular access for a molecule that would otherwise be excluded by the plasma membrane.

Why does PNC-27 selectively affect cancer cells over normal cells?▾

The selectivity is hypothesized to derive from differential surface display of HDM-2 protein. In normal cells, HDM-2 is primarily a nuclear protein with limited plasma-membrane localization; in many tumor types, HDM-2 is aberrantly displayed on the plasma membrane, where it becomes accessible to extracellular PNC-27 binding. When PNC-27 binds plasma-membrane-displayed HDM-2 in cancer cells, the interaction is hypothesized to drive membrane pore formation and selective tumor-cell death. Normal cells lacking surface HDM-2 are less susceptible. The selectivity is the basis for PNC-27's research interest as a tumor-selective membrane-disruption tool, though the mechanism details continue to be refined in the published literature.

PNC-27

p53-HDM2-binding · penetratin-fused research peptide

≥ 99.0%CAS Not consistently registered; see batch COALongevity Peptides

PeptideXpo buyer fit

PNC-27 for distributor assortment and OEM sourcing comparison

Use this page when the buyer is comparing multiple SKUs, fill ladders, repeat-order economics, or distributor/OEM sourcing routes.
For regulated compounding-pharmacy qualification, a dedicated regulated-pharmacy channel should own the pharmacy-specific head keyword.
For research-lab method development, copper-chemistry, or cosmetic-formulation depth, the matching specialist channel (research standards, copper peptides, or cosmetic actives) should own the narrower specialist intent.

Overview

Who buys this, and why

Primary buyer fit: academic and contract research laboratories.

Specifications

CAS: Not consistently registered; see batch COA
Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Appearance: White to off-white lyophilized powder
Purity (HPLC): ≥ 99.0%
Strength: 5 mg
Packaging: 10 vials/box · base pack (multiples of 10)
Half-life: ≈ 90 minutes
MOQ: On request
Lead time: 14–21 days
Storage: -20°C, protect from light

Documentation available on request

Certificate of Analysis (COA)
HPLC Chromatogram
Mass-spec identity (ESI-MS)
Copper-content verification (Cu-peptides only)
Stability in finished-formulation matrix
INCI naming for cosmetic use
SDS / MSDS
Sequence verification on request

Regulatory note

Research peptide; CAS is not consistently registered across suppliers. Sold for research use only.

Selected literature

Sarafraz-Yazdi E, Bowne WB, Adler V, Sookraj KA, Wu V, Shteyler V, Patel H, Oxbury W, Brandt-Rauf P, Zenilman ME, Michl J, Pincus MR. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010;107(5):1918-1923.
Sookraj KA, Bowne WB, Adler V, Sarafraz-Yazdi E, Michl J, Pincus MR. The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol. 2010;66(2):325-331.
Sarafraz-Yazdi E, Mumin S, Cheung D, Fridman D, Lin B, Wong L, Rosal R, Rudolph R, Frenkel M, Thadi A, Morano WF, Bowne WB, Pincus MR, Michl J. PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis. Biomedicines. 2022;10(5):945.
Krzesaj P, Adler V, Feinman RD, Miller A, Silberstein M, Yazdi E, Pincus MR. Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption. Ann Clin Lab Sci. 2024;54(2):137-148.
Miller AI, Miller L, Seydafkan S, Mc Glinchey S, Jafari G, Silberstein M, Krzesaj P, Feinman RD, Pincus MR. PNC-27 Kills Cervical Cancer Cells but Not Untransformed Cervical Cells, an Effect that is Enhanced by Ketone Bodies. Med Res Arch. 2025;13(5):e6471.
Sarafraz-Yazdi E, Gorelick C, Wagreich AR, Salame G, Angert M, Gartman CH, Gupta V, Bowne WB, Lee YC, Abulafia O, Pincus MR, Michl J. Ex vivo Efficacy of Anti-Cancer Drug PNC-27 in the Treatment of Patient-Derived Epithelial Ovarian Cancer. Ann Clin Lab Sci. 2015;45(6):650-658.

Frequently asked questions

What's the design rationale for PNC-27's two-domain structure?▾

Why does PNC-27 selectively affect cancer cells over normal cells?▾