Tesamorelin

PeptideXpo buyer fit

Overview

Tesamorelin is a synthetic 44-amino-acid GHRH analog with an N-terminal trans-3-hexenoyl modification that protects the molecule from DPP-4 cleavage and extends the plasma half-life relative to native GHRH or unmodified Sermorelin. It is the only FDA-approved member of the GHRH-analog class, indicated as a finished drug (Egrifta) for HIV-associated lipodystrophy and the reduction of excess visceral abdominal fat in HIV-positive patients with lipodystrophy. PeptideXpo supplies Tesamorelin acetate as a lyophilized powder at ≥99.0% HPLC purity. The 44-residue sequence is at the upper-middle range for SPPS, and the analytical packet emphasizes peak-integration HPLC plus ESI mass spec confirming the N-terminal hexenoyl modification, the modified mass is the diagnostic identity check. Sequence verification by LC-MS/MS is available when required by a written analytical scope because the hexenoyl group's positional integrity matters for biological activity. Tesamorelin is most commonly ordered as the standalone vial for visceral-fat research and compounding workflows, or as the pre-blended Tesamorelin + Ipamorelin combination (the tesa-ipa-blend SKU) for dual-pathway GH-axis research.

Who buys this, and why

GH-axis peptides ship to two main buyer types: compounding pharmacies dispensing under physician supervision, and research labs studying somatotropic-axis pharmacology. Pharmacies typically want sterile-filled vials with the full release packet (sterility, endotoxin, CCI); labs typically want bulk lyophilized powder with sequence verification. Blends (the CJC-1295 / Ipamorelin combination is the canonical example) are usually co-lyophilized rather than solution-mixed for potency stability.

Primary buyer fit: 503A / 503B compounding pharmacies and academic and contract research laboratories.

Specifications

CAS

218949-48-5

Sequence

(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Appearance

White to off-white lyophilized powder

Purity (HPLC)

≥ 99.0%

Strength

2 mg – 20 mg

Packaging

10 vials/box · base pack (multiples of 10)

Half-life

≈ 8 minutes

MOQ

On request

Lead time

10–18 days

Storage

Room temperature, protect from light

Documentation available on request

• Certificate of Analysis (COA)
• HPLC Chromatogram
• Mass-spec identity (ESI-MS)
• Counter-ion (acetate vs TFA)
• Sterile-fill release pack (sterility, CCI, fill-weight)
• Bacterial endotoxin (LAL, USP <85>)
• Stability data on request
• SDS / MSDS

Regulatory note

The finished Tesamorelin drug (Egrifta) is FDA-approved for HIV-associated lipodystrophy. The bulk active itself is not on the 503A bulks list; compounding eligibility for off-label or other indications depends on the destination market's current shortage / regulatory posture.

Selected literature

1. Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359-2370.
2. Falutz J, Potvin D, Mamputu JC, et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. J Acquir Immune Defic Syndr. 2010;53(3):311-322.
3. Stanley TL, Feldpausch MN, Oh J, et al. Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. JAMA. 2014;312(4):380-389.
4. Stanley TL, Fourman LT, Feldpausch MN, et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Lancet HIV. 2019;6(12):e821-e830.
5. Baker LD, Barsness SM, Borson S, et al. Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. Arch Neurol. 2012;69(11):1420-1429.
6. Badran AS, Helal A, Shata KS, Ayesh H. Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: a meta-analysis of randomized controlled trials. Obesity Research & Clinical Practice. 2026;20(1):2-12.

Frequently asked questions